Showing Protein Diphthine--ammonia ligase (HMDBP11712)
| Identification | |||
|---|---|---|---|
| HMDB Protein ID | HMDBP11712 | ||
| Secondary Accession Numbers | None | ||
| Name | Diphthine--ammonia ligase | ||
| Synonyms |
|
||
| Gene Name | ATPBD4 | ||
| Protein Type | Unknown | ||
| Biological Properties | |||
| General Function | Not Available | ||
| Specific Function | Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor eEF-2 (EEF2) to diphthamide (Probable). | ||
| Pathways |
|
||
| Reactions |
|
||
| GO Classification | Not Available | ||
| Cellular Location | Not Available | ||
| Gene Properties | |||
| Chromosome Location | 15 | ||
| Locus | 15q14 | ||
| SNPs | Not Available | ||
| Gene Sequence | Not Available | ||
| Protein Properties | |||
| Number of Residues | Not Available | ||
| Molecular Weight | 18657.27 | ||
| Theoretical pI | 6.409 | ||
| Pfam Domain Function |
|
||
| Signals | Not Available | ||
| Transmembrane Regions | Not Available | ||
| Protein Sequence |
>>gi|213972615|ref|NP_001135444.1| diphthine--ammonia ligase isoform 2 [Homo sapiens] MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDL YAEAMALPLY |
||
| External Links | |||
| GenBank ID Protein | Not Available | ||
| UniProtKB/Swiss-Prot ID | Q7L8W6 | ||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||
| PDB IDs | Not Available | ||
| GenBank Gene ID | Not Available | ||
| GeneCard ID | Not Available | ||
| GenAtlas ID | Not Available | ||
| HGNC ID | HGNC:30543 | ||
| References | |||
| General References | Not Available | ||