Hmdb loader
Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11712
Secondary Accession Numbers None
Name Diphthine--ammonia ligase
Synonyms
  1. ATP-binding domain-containing protein 4
  2. Diphthamide synthase
  3. Diphthamide synthetase
Gene Name ATPBD4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor eEF-2 (EEF2) to diphthamide (Probable).
Pathways
  • peptidyl-diphthamide biosynthesis
Reactions
Adenosine triphosphate + Diphthine + Ammonia → ADP + Phosphate + Diphthamide details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus 15q14
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 18657.27
Theoretical pI 6.409
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|213972615|ref|NP_001135444.1| diphthine--ammonia ligase isoform 2 [Homo sapiens]
MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDL
YAEAMALPLY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q7L8W6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30543
References
General References Not Available