You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11716
Secondary Accession Numbers None
Name DNA polymerase subunit gamma-2, mitochondrial
Synonyms
  1. DNA polymerase gamma accessory 55 kDa subunit
  2. Mitochondrial DNA polymerase accessory subunit
  3. MtPolB
  4. PolG-beta
  5. p55
Gene Name POLG2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mitochondrial polymerase processivity subunit. Stimulates the polymerase and exonuclease activities, and increases the processivity of the enzyme. Binds to ss-DNA.
Pathways Not Available
Reactions
Deoxynucleoside triphosphate + DNA(n) → Pyrophosphate + DNA(n+1) details
GO Classification
Biological Process
DNA repair
DNA-dependent DNA replication
glycyl-tRNA aminoacylation
Cellular Component
mitochondrial chromosome
Molecular Function
ATP binding
single-stranded DNA binding
DNA-directed DNA polymerase activity
glycine-tRNA ligase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 54910.67
Theoretical pI 8.36
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|70887790|ref|NP_009146.2| DNA polymerase subunit gamma-2, mitochondrial [Homo sapiens]
MRSRVAVRACHKVCRCLLSGFGGRVDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAP
GSGEGSEALL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UHN1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9180
References
General References Not Available