You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11717
Secondary Accession Numbers None
Name DNA polymerase nu
Synonyms Not Available
Gene Name POLN
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways
  • Fanconi anemia pathway
Reactions
Deoxynucleoside triphosphate + DNA(n) → Pyrophosphate + DNA(n+1) details
GO Classification
Biological Process
DNA repair
DNA replication
Cellular Component
nucleus
Molecular Function
DNA-directed DNA polymerase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p16.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 100306.155
Theoretical pI 8.29
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|112420958|ref|NP_861524.2| DNA polymerase nu [Homo sapiens]
MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQL
EDRKTQSPEK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q7Z5Q5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18870
References
General References Not Available