Showing Protein ATP-dependent RNA helicase DDX39A (HMDBP11724)
| Identification | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11724 | ||||||||||
| Secondary Accession Numbers | None | ||||||||||
| Name | ATP-dependent RNA helicase DDX39A | ||||||||||
| Synonyms |
|
||||||||||
| Gene Name | DDX39A | ||||||||||
| Protein Type | Unknown | ||||||||||
| Biological Properties | |||||||||||
| General Function | Not Available | ||||||||||
| Specific Function | Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus. | ||||||||||
| Pathways | Not Available | ||||||||||
| Reactions |
|
||||||||||
| GO Classification |
|
||||||||||
| Cellular Location | Not Available | ||||||||||
| Gene Properties | |||||||||||
| Chromosome Location | 19 | ||||||||||
| Locus | 19p13.12 | ||||||||||
| SNPs | Not Available | ||||||||||
| Gene Sequence | Not Available | ||||||||||
| Protein Properties | |||||||||||
| Number of Residues | Not Available | ||||||||||
| Molecular Weight | 49129.15 | ||||||||||
| Theoretical pI | 5.676 | ||||||||||
| Pfam Domain Function | Not Available | ||||||||||
| Signals | Not Available | ||||||||||
| Transmembrane Regions | Not Available | ||||||||||
| Protein Sequence |
>>gi|21040371|ref|NP_005795.2| ATP-dependent RNA helicase DDX39A [Homo sapiens] MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIV DCGFEHPSEV |
||||||||||
| External Links | |||||||||||
| GenBank ID Protein | Not Available | ||||||||||
| UniProtKB/Swiss-Prot ID | O00148 | ||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
| PDB IDs | Not Available | ||||||||||
| GenBank Gene ID | Not Available | ||||||||||
| GeneCard ID | Not Available | ||||||||||
| GenAtlas ID | Not Available | ||||||||||
| HGNC ID | HGNC:17821 | ||||||||||
| References | |||||||||||
| General References | Not Available | ||||||||||