Hmdb loader
Identification
HMDB Protein ID HMDBP11725
Secondary Accession Numbers None
Name Dihydrofolate reductase, mitochondrial
Synonyms
  1. Dihydrofolate reductase-like protein 1
Gene Name DHFRL1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.
Pathways
  • Folate biosynthesis
  • One carbon pool by folate
  • tetrahydrofolate biosynthesis
Reactions
Tetrahydrofolic acid + NADP → Dihydrofolic acid + NADPH details
Tetrahydrofolic acid + NAD → Dihydrofolic acid + NADH + Hydrogen Ion details
Tetrahydrofolic acid + NAD → Folic acid + NADH + Hydrogen Ion details
Tetrahydrofolic acid + NADP → Dihydrofolic acid + NADPH + Hydrogen Ion details
Tetrahydrofolic acid + NADP → Folic acid + NADPH + Hydrogen Ion details
Dihydrofolic acid + NAD → Folic acid + NADH + Hydrogen Ion details
Dihydrofolic acid + NADP → Folic acid + NADPH + Hydrogen Ion details
GO Classification
Biological Process
one-carbon metabolic process
tetrahydrofolate metabolic process
nucleotide biosynthetic process
glycine biosynthetic process
tetrahydrofolate biosynthetic process
thymidine biosynthetic process
Cellular Component
mitochondrial inner membrane
mitochondrial matrix
Molecular Function
NADP binding
dihydrofolate reductase activity
mRNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q11.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 21619.88
Theoretical pI 7.972
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|307548863|ref|NP_001182572.1| dihydrofolate reductase, mitochondrial [Homo sapiens]
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q86XF0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:27309
References
General References Not Available