Showing Protein Ethylmalonyl-CoA decarboxylase (HMDBP11726)
Identification | ||||||
---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11726 | |||||
Secondary Accession Numbers | None | |||||
Name | Ethylmalonyl-CoA decarboxylase | |||||
Synonyms |
|
|||||
Gene Name | ECHDC1 | |||||
Protein Type | Unknown | |||||
Biological Properties | ||||||
General Function | Not Available | |||||
Specific Function | Decarboxylases ethylmalonyl-CoA decarboxylase, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activityx at lower level. | |||||
Pathways | Not Available | |||||
Reactions |
|
|||||
GO Classification |
|
|||||
Cellular Location | Not Available | |||||
Gene Properties | ||||||
Chromosome Location | 6 | |||||
Locus | 6q22.33 | |||||
SNPs | Not Available | |||||
Gene Sequence | Not Available | |||||
Protein Properties | ||||||
Number of Residues | Not Available | |||||
Molecular Weight | 32996.93 | |||||
Theoretical pI | 8.213 | |||||
Pfam Domain Function | Not Available | |||||
Signals | Not Available | |||||
Transmembrane Regions | Not Available | |||||
Protein Sequence |
>>gi|157694516|ref|NP_001002030.1| ethylmalonyl-CoA decarboxylase isoform 1 [Homo sapiens] MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGI LTLNNPSRMN |
|||||
External Links | ||||||
GenBank ID Protein | Not Available | |||||
UniProtKB/Swiss-Prot ID | Q9NTX5 | |||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
PDB IDs | Not Available | |||||
GenBank Gene ID | Not Available | |||||
GeneCard ID | Not Available | |||||
GenAtlas ID | Not Available | |||||
HGNC ID | HGNC:21489 | |||||
References | ||||||
General References | Not Available |