You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11726
Secondary Accession Numbers None
Name Ethylmalonyl-CoA decarboxylase
Synonyms
  1. Enoyl-CoA hydratase domain-containing protein 1
  2. Methylmalonyl-CoA decarboxylase
  3. MMCD
Gene Name ECHDC1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Decarboxylases ethylmalonyl-CoA decarboxylase, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activityx at lower level.
Pathways Not Available
Reactions
(S)-ethylmalonyl-CoA → Butyryl-CoA + CO(2) details
S-Methylmalonyl-CoA → Propionyl-CoA + CO(2) details
GO Classification
Cellular Component
cytosol
Molecular Function
carboxy-lyase activity
methylmalonyl-CoA decarboxylase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q22.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 32996.93
Theoretical pI 8.213
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|157694516|ref|NP_001002030.1| ethylmalonyl-CoA decarboxylase isoform 1 [Homo sapiens]
MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGI
LTLNNPSRMN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NTX5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21489
References
General References Not Available