Hmdb loader

Showing Protein Elongation of very long chain fatty acids protein 6 (HMDBP11729)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 5 metabolites
Identification
HMDB Protein ID HMDBP11729
Secondary Accession Numbers None
Name Elongation of very long chain fatty acids protein 6
Synonyms
  1. 3-keto acyl-CoA synthase ELOVL6
  2. ELOVL fatty acid elongase 6
  3. Fatty acid elongase 2
  4. Fatty acyl-CoA elongase
  5. Long-chain fatty-acyl elongase
  6. Very-long-chain 3-oxoacyl-CoA synthase 6
  7. ELOVL FA elongase 6
  8. hELO2
Gene Name ELOVL6
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. Highest activity toward C16:0 acyl-CoAs.
Pathways
  • Biosynthesis of unsaturated fatty acids
  • Fatty acid elongation
Reactions
A very-long-chain acyl-CoA + Malonyl-CoA → Coenzyme A + a very-long-chain 3-oxoacyl-CoA + CO(2) details
Malonyl-CoA + Palmityl-CoA → 3-Oxooctadecanoyl-CoA + Coenzyme A + Carbon dioxide details
Hexadecanoyl-[acp] + Malonyl-[acyl-carrier protein] → 3-Oxostearoyl-[acp] + Acyl-carrier protein + Carbon dioxide details
Malonyl-CoA + Acyl-CoA → 3-Oxoacyl-CoA + Coenzyme A + Carbon dioxide details
GO Classification
Biological Process
fatty acid elongation, monounsaturated fatty acid
fatty acid elongation, saturated fatty acid
long-chain fatty acid biosynthetic process
long-chain fatty-acyl-CoA biosynthetic process
triglyceride biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to endoplasmic reticulum membrane
Molecular Function
fatty acid elongase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q25
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 31375.81
Theoretical pI 9.369
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|195539343|ref|NP_001124193.1| elongation of very long chain fatty acids protein 6 [Homo sapiens]
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
KPLVLWSLTL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H5J4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:15829
References
General References Not Available