Hmdb loader
Identification
HMDB Protein ID HMDBP11730
Secondary Accession Numbers None
Name Elongation of very long chain fatty acids protein 7
Synonyms
  1. 3-keto acyl-CoA synthase ELOVL7
  2. ELOVL fatty acid elongase 7
  3. Very-long-chain 3-oxoacyl-CoA synthase 7
  4. ELOVL FA elongase 7
Gene Name ELOVL7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs.
Pathways
  • Fatty acid elongation
Reactions
A very-long-chain acyl-CoA + Malonyl-CoA → Coenzyme A + a very-long-chain 3-oxoacyl-CoA + CO(2) details
Malonyl-CoA + Acyl-CoA → 3-Oxoacyl-CoA + Coenzyme A + Carbon dioxide details
GO Classification
Biological Process
fatty acid elongation, saturated fatty acid
very long-chain fatty acid biosynthetic process
fatty acid elongation, polyunsaturated fatty acid
long-chain fatty-acyl-CoA biosynthetic process
triglyceride biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
transferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q12.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 33356.06
Theoretical pI 9.266
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|157388949|ref|NP_001098028.1| elongation of very long chain fatty acids protein 7 [Homo sapiens]
MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRK
PFELKKAMIT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID A1L3X0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26292
References
General References Not Available