Hmdb loader
Identification
HMDB Protein ID HMDBP11731
Secondary Accession Numbers None
Name EGF domain-specific O-linked N-acetylglucosamine transferase
Synonyms
  1. Extracellular O-linked N-acetylglucosamine transferase
Gene Name EOGT
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Thr residue located between the fifth and sixth conserved cysteines of folded EGF-like domains (By similarity).
Pathways Not Available
Reactions
Uridine diphosphate-N-acetylglucosamine + [protein]-L-serine → Uridine 5'-diphosphate + [protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine details
Uridine diphosphate-N-acetylglucosamine + [protein]-L-threonine → Uridine 5'-diphosphate + [protein]-3-O-(N-acetyl-D-glucosaminyl)-L-threonine details
GO Classification
Biological Process
protein O-linked glycosylation
Cellular Component
endoplasmic reticulum lumen
Molecular Function
protein N-acetylglucosaminyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3p14.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 52296.26
Theoretical pI 6.818
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|39930531|ref|NP_775925.1| EGF domain-specific O-linked N-acetylglucosamine transferase precursor [Homo sapiens]
MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATV
CRKDSLCPYK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5NDL2
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28526
References
General References Not Available