You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11732
Secondary Accession Numbers None
Name DNA excision repair protein ERCC-6-like
Synonyms
  1. ATP-dependent helicase ERCC6-like
  2. PLK1-interacting checkpoint helicase
  3. Tumor antigen BJ-HCC-15
Gene Name ERCC6L
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA helicase that acts as an essential component of the spindle assembly checkpoint. Contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. Acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
cell division
mitotic prometaphase
Cellular Component
cytosol
condensed chromosome kinetochore
Molecular Function
ATP binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xq13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 141101.715
Theoretical pI 5.309
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|58331268|ref|NP_060139.2| DNA excision repair protein ERCC-6-like [Homo sapiens]
MEASRRFPEAEALSPEQAAHYLRYVKEAKEATKNGDLEEAFKLFNLAKDIFPNEKVLSRI
QKIQEALEEL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q2NKX8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20794
References
General References Not Available