You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11733
Secondary Accession Numbers None
Name TFIIH basal transcription factor complex helicase XPB subunit
Synonyms
  1. Basic transcription factor 2 89 kDa subunit
  2. DNA excision repair protein ERCC-3
  3. DNA repair protein complementing XP-B cells
  4. TFIIH basal transcription factor complex 89 kDa subunit
  5. Xeroderma pigmentosum group B-complementing protein
  6. BTF2 p89
  7. TFIIH 89 kDa subunit
  8. TFIIH p89
Gene Name ERCC3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.
Pathways
  • Basal transcription factors
  • Nucleotide excision repair
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
transcription-coupled nucleotide-excision repair
response to oxidative stress
7-methylguanosine mRNA capping
cell cycle checkpoint
protein localization
hair cell differentiation
nucleotide-excision repair, DNA damage removal
nucleotide-excision repair, DNA incision
termination of RNA polymerase I transcription
transcription elongation from RNA polymerase I promoter
transcription initiation from RNA polymerase I promoter
response to UV
DNA topological change
nucleotide-excision repair, DNA duplex unwinding
induction of apoptosis
virus-host interaction
viral reproduction
positive regulation of transcription from RNA polymerase II promoter
UV protection
response to hypoxia
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
holo TFIIH complex
SSL2-core TFIIH complex
Molecular Function
ATP binding
transcription factor binding
ATP-dependent DNA helicase activity
peptide binding
3'-5' DNA helicase activity
dATP binding
RNA polymerase II carboxy-terminal domain kinase activity
damaged DNA binding
ATPase activity
GTP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 89276.985
Theoretical pI 7.227
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4557563|ref|NP_000113.1| TFIIH basal transcription factor complex helicase XPB subunit [Homo sapiens]
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P19447
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:3435
References
General References Not Available