You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11734
Secondary Accession Numbers None
Name Fanconi anemia group J protein
Synonyms
  1. Protein FACJ
  2. ATP-dependent RNA helicase BRIP1
  3. BRCA1-associated C-terminal helicase 1
  4. BRCA1-interacting protein C-terminal helicase 1
  5. BRCA1-interacting protein 1
Gene Name BRIP1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent ATPase and 5' to 3' DNA helicase required for the maintenance of chromosomal stability. Acts late in the Fanconi anemia pathway, after FANCD2 ubiquitination. Involved in the repair of DNA double-strand breaks by homologous recombination in a manner that depends on its association with BRCA1.
Pathways
  • Fanconi anemia pathway
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
double-strand break repair
regulation of transcription from RNA polymerase II promoter
DNA damage checkpoint
Cellular Component
cytoplasm
nuclear membrane
Molecular Function
metal ion binding
ATP binding
4 iron, 4 sulfur cluster binding
ATP-dependent DNA helicase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q22.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 140866.21
Theoretical pI 6.917
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|301897118|ref|NP_114432.2| Fanconi anemia group J protein [Homo sapiens]
MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSA
LAWQQSLSGK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BX63
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20473
References
General References Not Available