Showing Protein F-box only protein 18 (HMDBP11736)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11736 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | F-box only protein 18 | ||||||
| Synonyms |
|
||||||
| Gene Name | FBXO18 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | DNA-dependent ATPase. Unwinds double-stranded DNA in a 3' to 5' direction. Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. | ||||||
| Pathways | Not Available | ||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 10 | ||||||
| Locus | 10p15.1 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 110906.485 | ||||||
| Theoretical pI | 7.408 | ||||||
| Pfam Domain Function | |||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|386268044|ref|NP_001245381.1| F-box only protein 18 isoform 3 [Homo sapiens] MAKSNSVGQDSCQDSEGDMIFPAESSCALPQEGSAGPGSPGSAPPSRKRSWSSEEESNQA TGTSRWDGVS |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q8NFZ0 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:13620 | ||||||
| References | |||||||
| General References | Not Available | ||||||