Showing Protein Fucose mutarotase (HMDBP11738)
| Identification | ||||||
|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11738 | |||||
| Secondary Accession Numbers | None | |||||
| Name | Fucose mutarotase | |||||
| Synonyms | Not Available | |||||
| Gene Name | FUOM | |||||
| Protein Type | Unknown | |||||
| Biological Properties | ||||||
| General Function | Not Available | |||||
| Specific Function | Involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by the de novo or salvage pathways is transported into the endoplasmic reticulum, where it serves as a substrate for N- and O-glycosylations by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are believed to play a critical role in cell-cell adhesion and recognition processes. | |||||
| Pathways | Not Available | |||||
| Reactions |
|
|||||
| GO Classification |
|
|||||
| Cellular Location | Not Available | |||||
| Gene Properties | ||||||
| Chromosome Location | 10 | |||||
| Locus | 10q26.3 | |||||
| SNPs | Not Available | |||||
| Gene Sequence | Not Available | |||||
| Protein Properties | ||||||
| Number of Residues | Not Available | |||||
| Molecular Weight | 16764.555 | |||||
| Theoretical pI | 5.581 | |||||
| Pfam Domain Function |
|
|||||
| Signals | Not Available | |||||
| Transmembrane Regions | Not Available | |||||
| Protein Sequence |
>>gi|148596947|ref|NP_001091953.1| fucose mutarotase isoform 1 [Homo sapiens] MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLE AVLKLLPLDT |
|||||
| External Links | ||||||
| GenBank ID Protein | Not Available | |||||
| UniProtKB/Swiss-Prot ID | A2VDF0 | |||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
| PDB IDs | Not Available | |||||
| GenBank Gene ID | Not Available | |||||
| GeneCard ID | Not Available | |||||
| GenAtlas ID | Not Available | |||||
| HGNC ID | HGNC:24733 | |||||
| References | ||||||
| General References | Not Available | |||||