Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11739
Secondary Accession Numbers None
Name Galactoside 3(4)-L-fucosyltransferase
Synonyms
  1. Blood group Lewis alpha-4-fucosyltransferase
  2. Fucosyltransferase 3
  3. Fucosyltransferase III
  4. Lewis FT
  5. FucT-III
Gene Name FUT3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May catalyze alpha-1,3 and alpha-1,4 glycosidic linkages involved in the expression of Vim-2, Lewis A, Lewis B, sialyl Lewis X and Lewis X/SSEA-1 antigens. May be involved in blood group Lewis determination; Lewis-positive (Le(+)) individuals have an active enzyme while Lewis-negative (Le(-)) individuals have an inactive enzyme. Also acts on the corresponding 1,4-galactosyl derivative, forming 1,3-L-fucosyl links.
Pathways
  • Glycosphingolipid biosynthesis - lacto and neolacto series
  • protein glycosylation
Reactions
GDP-L-fucose + beta-D-galactosyl-(1->3)-N-acetyl-D-glucosaminyl-R → Guanosine diphosphate + beta-D-galactosyl-(1->3)-(alpha-L-fucosyl-(1->4))-N-acetyl-beta-D-glucosaminyl-R details
GDP-L-fucose + Paragloboside → GDP + III3Fuc-nLc4Cer details
GDP-L-fucose + nLc6Cer → GDP + V3Fuc-nLc6Cer details
GDP-L-fucose + nLc8Cer → GDP + details
GDP-L-fucose + Sialyl-3-paragloboside → GDP + IV3NeuAc,III3Fuc-nLc4Cer details
GDP-L-fucose + VI2Fuc-nLc6 → GDP + details
GDP-L-fucose + IV2Fuc-nLc4Cer → GDP + III3,IV2Fuc-nLc4Cer details
GDP-L-fucose + Lc4Cer → GDP + Fuc-Lc4Cer details
GDP-L-fucose + Type IA glycolipid → GDP + details
GDP-L-fucose + IV2Fuc-Lc4Cer → GDP + IV2Fuc,III4Fuc-Lc4Cer details
GDP-L-fucose + Type IB glycolipid → GDP + details
GDP-L-fucose + 3'-isoLM1 → GDP + Fuc-3'-isoLM1 details
GDP-L-fucose + V3Fuc-nLc6Cer → GDP + V3Fuc,III3Fuc-nLc6Cer details
GDP-L-fucose + → GDP + details
GDP-L-fucose + → GDP + details
GDP-L-fucose + → GDP + details
GDP-L-fucose + nLc6Cer → GDP + III3Fuc-nLc6Cer details
GO Classification
Biological Process
oligosaccharide biosynthetic process
cell-cell recognition
macromolecule glycosylation
protein glycosylation
Cellular Component
Golgi cisterna membrane
membrane
integral to membrane
Molecular Function
3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity
alpha-(1->3)-fucosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 42116.69
Theoretical pI 9.006
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4503809|ref|NP_000140.1| galactoside 3(4)-L-fucosyltransferase [Homo sapiens]
MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTR
PTLLILLWTW
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P21217
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4014
References
General References Not Available