Hmdb loader
Identification
HMDB Protein ID HMDBP11741
Secondary Accession Numbers None
Name Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
Synonyms
  1. Glu-AdT subunit C
  2. Protein 15E1.2
Gene Name GATC
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Pathways Not Available
Reactions
Adenosine triphosphate + L-glutamyl-tRNA(Gln) + L-Glutamine → ADP + Phosphate + L-glutaminyl-tRNA(Gln) + L-Glutamic acid details
GO Classification
Biological Process
glutaminyl-tRNAGln biosynthesis via transamidation
mitochondrial translation
regulation of translational fidelity
Cellular Component
mitochondrion
glutamyl-tRNA(Gln) amidotransferase complex
Molecular Function
ATP binding
glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q24.31
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 15085.885
Theoretical pI 5.041
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|50978624|ref|NP_789788.1| glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Homo sapiens]
MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKA
IAFADRLRAV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O43716
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25068
References
General References Not Available