Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11742
Secondary Accession Numbers None
Name Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
Synonyms
  1. Core 2-branching enzyme
  2. Core2-GlcNAc-transferase
  3. C2GNT
  4. Core 2 GNT
Gene Name GCNT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Forms critical branches in O-glycans.
Pathways
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + beta-D-galactosyl-1,3-N-acetyl-D-galactosaminyl-R → Uridine 5'-diphosphate + beta-D-galactosyl-1,3-(N-acetyl-beta-D-glucosaminyl-1,6)-N-acetyl-D-galactosaminyl-R details
UDP-N-acetyl-D-glucosamine + Tn antigen → UDP + details
UDP-N-acetyl-D-glucosamine + T antigen → UDP + details
GO Classification
Biological Process
O-glycan processing
response to insulin stimulus
post-translational protein modification
kidney morphogenesis
tissue morphogenesis
Cellular Component
extracellular space
integral to membrane
Golgi membrane
Molecular Function
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49798.425
Theoretical pI 8.418
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|148277029|ref|NP_001091102.1| beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase [Homo sapiens]
MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCT
KVLQGDVNEI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q02742
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4203
References
General References Not Available