Showing Protein GDP-D-glucose phosphorylase 1 (HMDBP11745)
| Identification | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11745 | ||||||||||
| Secondary Accession Numbers | None | ||||||||||
| Name | GDP-D-glucose phosphorylase 1 | ||||||||||
| Synonyms | Not Available | ||||||||||
| Gene Name | GDPGP1 | ||||||||||
| Protein Type | Unknown | ||||||||||
| Biological Properties | |||||||||||
| General Function | Not Available | ||||||||||
| Specific Function | Specific and highly efficient GDP-D-glucose phosphorylase regulating the levels of GDP-D-glucose in cells. | ||||||||||
| Pathways | Not Available | ||||||||||
| Reactions |
|
||||||||||
| GO Classification |
|
||||||||||
| Cellular Location | Not Available | ||||||||||
| Gene Properties | |||||||||||
| Chromosome Location | 15 | ||||||||||
| Locus | 15q26.1 | ||||||||||
| SNPs | Not Available | ||||||||||
| Gene Sequence | Not Available | ||||||||||
| Protein Properties | |||||||||||
| Number of Residues | Not Available | ||||||||||
| Molecular Weight | 42362.06 | ||||||||||
| Theoretical pI | 6.469 | ||||||||||
| Pfam Domain Function | Not Available | ||||||||||
| Signals | Not Available | ||||||||||
| Transmembrane Regions | Not Available | ||||||||||
| Protein Sequence |
>>gi|116642895|ref|NP_001013679.2| GDP-D-glucose phosphorylase 1 [Homo sapiens] MALPHDSNETSYLLPPNNEDWGRQTIPDFVYGQKDLMAEGIQWPRNAPGIPDALPQSPFD AALCSAWKQR |
||||||||||
| External Links | |||||||||||
| GenBank ID Protein | Not Available | ||||||||||
| UniProtKB/Swiss-Prot ID | Q6ZNW5 | ||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
| PDB IDs | Not Available | ||||||||||
| GenBank Gene ID | Not Available | ||||||||||
| GeneCard ID | Not Available | ||||||||||
| GenAtlas ID | Not Available | ||||||||||
| HGNC ID | HGNC:34360 | ||||||||||
| References | |||||||||||
| General References | Not Available | ||||||||||