| Identification |
| HMDB Protein ID
| HMDBP11757 |
| Secondary Accession Numbers
| None |
| Name
| Procollagen galactosyltransferase 1 |
| Synonyms
|
- Glycosyltransferase 25 family member 1
- Hydroxylysine galactosyltransferase 1
|
| Gene Name
| GLT25D1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Has a beta-galactosyltransferase activity; transfers beta-galactose to hydroxylysine residues of collagen.
|
| Pathways
|
- Lysine degradation
- Other types of O-glycan biosynthesis
|
| Reactions
|
| Uridine diphosphategalactose + 5-hydroxy-L-lysine-[procollagen] → Uridine 5'-diphosphate + 5-(D-galactosyloxy)-L-lysine-[procollagen] |
details
|
| Uridine diphosphategalactose + Procollagen 5-hydroxy-L-lysine → Uridine 5'-diphosphate + 5-(D-Galactosyloxy)-L-lysine-procollagen |
details
|
|
| GO Classification
|
| Biological Process |
| extracellular matrix organization |
| lipopolysaccharide biosynthetic process |
| Cellular Component |
| endoplasmic reticulum lumen |
| Molecular Function |
| procollagen galactosyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 19 |
| Locus
| 19p13.11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 71635.385 |
| Theoretical pI
| 7.311 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|31377697|ref|NP_078932.2| procollagen galactosyltransferase 1 precursor [Homo sapiens]
MAAAPRAGRRRGQPLLALLLLLLAPLPPGAPPGADAYFPEERWSPESPLQAPRVLIALLA
RNAAHALPTT
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NBJ5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26182 |
| References |
| General References
| Not Available |