Hmdb loader
Identification
HMDB Protein ID HMDBP11760
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 10
Synonyms
  1. Glucose transporter type 10
  2. GLUT-10
Gene Name SLC2A10
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Facilitative glucose transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
glucose transport
Cellular Component
plasma membrane
perinuclear region of cytoplasm
endomembrane system
integral to membrane
Molecular Function
sugar:hydrogen symporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 20
Locus 20q13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56910.77
Theoretical pI 8.584
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|13540547|ref|NP_110404.1| solute carrier family 2, facilitated glucose transporter member 10 [Homo sapiens]
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLID
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95528
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13444
References
General References Not Available