You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Solute carrier family 2, facilitated glucose transporter member 12 (HMDBP11762)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11762 | ||||||||||
Secondary Accession Numbers | None | ||||||||||
Name | Solute carrier family 2, facilitated glucose transporter member 12 | ||||||||||
Synonyms |
|
||||||||||
Gene Name | SLC2A12 | ||||||||||
Protein Type | Unknown | ||||||||||
Biological Properties | |||||||||||
General Function | Not Available | ||||||||||
Specific Function | Facilitative glucose transporter (By similarity). | ||||||||||
Pathways | Not Available | ||||||||||
Reactions | Not Available | ||||||||||
GO Classification |
|
||||||||||
Cellular Location | Not Available | ||||||||||
Gene Properties | |||||||||||
Chromosome Location | 6 | ||||||||||
Locus | 6q23.2 | ||||||||||
SNPs | Not Available | ||||||||||
Gene Sequence | Not Available | ||||||||||
Protein Properties | |||||||||||
Number of Residues | Not Available | ||||||||||
Molecular Weight | 66965.7 | ||||||||||
Theoretical pI | 8.363 | ||||||||||
Pfam Domain Function | Not Available | ||||||||||
Signals | Not Available | ||||||||||
Transmembrane Regions | Not Available | ||||||||||
Protein Sequence |
>>gi|21553331|ref|NP_660159.1| solute carrier family 2, facilitated glucose transporter member 12 [Homo sapiens] MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGI ISGALLQIKT |
||||||||||
External Links | |||||||||||
GenBank ID Protein | Not Available | ||||||||||
UniProtKB/Swiss-Prot ID | Q8TD20 | ||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
PDB IDs | Not Available | ||||||||||
GenBank Gene ID | Not Available | ||||||||||
GeneCard ID | Not Available | ||||||||||
GenAtlas ID | Not Available | ||||||||||
HGNC ID | HGNC:18067 | ||||||||||
References | |||||||||||
General References | Not Available |