Showing Protein Solute carrier family 2, facilitated glucose transporter member 14 (HMDBP11763)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11763 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | Solute carrier family 2, facilitated glucose transporter member 14 | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | SLC2A14 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis. | |||||||||
| Pathways | Not Available | |||||||||
| Reactions | Not Available | |||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 12 | |||||||||
| Locus | 12p13.31 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 56319.575 | |||||||||
| Theoretical pI | 7.82 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|23592238|ref|NP_703150.1| solute carrier family 2, facilitated glucose transporter member 14 [Homo sapiens] MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET IIKEFINKTL |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q8TDB8 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:18301 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||