Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11765
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 4
Synonyms
  1. Glucose transporter type 4, insulin-responsive
  2. GLUT-4
Gene Name SLC2A4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Insulin-regulated facilitative glucose transporter.
Pathways
  • Adipocytokine signaling pathway
  • Glucose-Alanine Cycle
  • Insulin signaling pathway
  • Insulin Signalling
  • Type II diabetes mellitus
Reactions Not Available
GO Classification
Biological Process
small molecule metabolic process
response to ethanol
brown fat cell differentiation
glucose import
cellular response to insulin stimulus
glucose homeostasis
carbohydrate metabolic process
Cellular Component
extracellular vesicular exosome
perinuclear region of cytoplasm
clathrin-coated vesicle
coated pit
insulin-responsive compartment
multivesicular body
vesicle membrane
trans-Golgi network transport vesicle
external side of plasma membrane
integral to plasma membrane
sarcolemma
Molecular Function
glucose transmembrane transporter activity
D-glucose transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17p13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 54786.79
Theoretical pI 6.931
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4507011|ref|NP_001033.1| solute carrier family 2, facilitated glucose transporter member 4 [Homo sapiens]
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P14672
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11009
References
General References Not Available