You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11766
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 5
Synonyms
  1. Fructose transporter
  2. Glucose transporter type 5, small intestine
  3. GLUT-5
Gene Name SLC2A5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Cytochalasin B-sensitive carrier. Seems to function primarily as a fructose transporter.
Pathways
  • Carbohydrate digestion and absorption
Reactions Not Available
GO Classification
Biological Process
small molecule metabolic process
carbohydrate metabolic process
Cellular Component
plasma membrane
integral to membrane
Molecular Function
glucose transmembrane transporter activity
fructose transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p36.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 26518.715
Theoretical pI 7.461
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|207447703|ref|NP_001129057.1| solute carrier family 2, facilitated glucose transporter member 5 isoform 2 [Homo sapiens]
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P22732
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11010
References
General References Not Available