Showing Protein Solute carrier family 2, facilitated glucose transporter member 5 (HMDBP11766)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11766 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Solute carrier family 2, facilitated glucose transporter member 5 | |||||||||
Synonyms |
|
|||||||||
Gene Name | SLC2A5 | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Cytochalasin B-sensitive carrier. Seems to function primarily as a fructose transporter. | |||||||||
Pathways |
|
|||||||||
Reactions | Not Available | |||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 1 | |||||||||
Locus | 1p36.2 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 26518.715 | |||||||||
Theoretical pI | 7.461 | |||||||||
Pfam Domain Function | Not Available | |||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|207447703|ref|NP_001129057.1| solute carrier family 2, facilitated glucose transporter member 5 isoform 2 [Homo sapiens] MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE FMEDFPLTLL |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | P22732 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | ||||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:11010 | |||||||||
References | ||||||||||
General References | Not Available |