Showing Protein Solute carrier family 2, facilitated glucose transporter member 6 (HMDBP11767)
| Identification | ||||||
|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11767 | |||||
| Secondary Accession Numbers | None | |||||
| Name | Solute carrier family 2, facilitated glucose transporter member 6 | |||||
| Synonyms |
|
|||||
| Gene Name | SLC2A6 | |||||
| Protein Type | Unknown | |||||
| Biological Properties | ||||||
| General Function | Not Available | |||||
| Specific Function | Facilitative glucose transporter; binds cytochalasin B with low affinity. | |||||
| Pathways | Not Available | |||||
| Reactions | Not Available | |||||
| GO Classification |
|
|||||
| Cellular Location | Not Available | |||||
| Gene Properties | ||||||
| Chromosome Location | 9 | |||||
| Locus | 9q34 | |||||
| SNPs | Not Available | |||||
| Gene Sequence | Not Available | |||||
| Protein Properties | ||||||
| Number of Residues | Not Available | |||||
| Molecular Weight | 48039.99 | |||||
| Theoretical pI | 9.011 | |||||
| Pfam Domain Function | Not Available | |||||
| Signals | Not Available | |||||
| Transmembrane Regions | Not Available | |||||
| Protein Sequence |
>>gi|223029430|ref|NP_001138571.1| solute carrier family 2, facilitated glucose transporter member 6 isoform 2 [Homo sapiens] MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS PVIPALERSL |
|||||
| External Links | ||||||
| GenBank ID Protein | Not Available | |||||
| UniProtKB/Swiss-Prot ID | Q9UGQ3 | |||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||
| PDB IDs | Not Available | |||||
| GenBank Gene ID | Not Available | |||||
| GeneCard ID | Not Available | |||||
| GenAtlas ID | Not Available | |||||
| HGNC ID | HGNC:11011 | |||||
| References | ||||||
| General References | Not Available | |||||