Showing Protein Solute carrier family 2, facilitated glucose transporter member 7 (HMDBP11768)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11768 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Solute carrier family 2, facilitated glucose transporter member 7 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | SLC2A7 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | High-affinity transporter for glucose and fructose Does not transport galactose, 2-deoxy-d-glucose and xylose. | ||||||||
| Pathways | Not Available | ||||||||
| Reactions | Not Available | ||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 1 | ||||||||
| Locus | 1p36.2 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 55726.915 | ||||||||
| Theoretical pI | 8.41 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|134053883|ref|NP_997303.2| solute carrier family 2, facilitated glucose transporter member 7 [Homo sapiens] MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY FERHATFMDG |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q6PXP3 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | |||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:13445 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||