| Identification |
|---|
| HMDB Protein ID
| HMDBP11770 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 2, facilitated glucose transporter member 9 |
| Synonyms
|
- Glucose transporter type 9
- GLUT-9
|
| Gene Name
| SLC2A9 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Transport urate and fructose. May have a role in the urate reabsorption by proximal tubules. Also transports glucose at low rate.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| glucose transport |
| urate metabolic process |
| Cellular Component |
| plasma membrane |
| nuclear envelope |
| integral to membrane |
| integral to plasma membrane |
| Molecular Function |
| sugar:hydrogen symporter activity |
| glucose transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4p16.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 55720.81 |
| Theoretical pI
| 8.508 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|47933389|ref|NP_001001290.1| solute carrier family 2, facilitated glucose transporter member 9 isoform 2 [Homo sapiens]
MKLSKKDRGEDEESDSAKKKLDWSCSLLVASLAGAFGSSFLYGYNLSVVNAPTPYIKAFY
NESWERRHGR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NRM0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:13446 |
| References |
|---|
| General References
| Not Available |
