Showing Protein Glucoside xylosyltransferase 2 (HMDBP11772)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11772 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | Glucoside xylosyltransferase 2 | ||||||
| Synonyms |
|
||||||
| Gene Name | GXYLT2 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose. | ||||||
| Pathways |
|
||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 3 | ||||||
| Locus | 3p13 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 51055.05 | ||||||
| Theoretical pI | 9.769 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|122937187|ref|NP_001073862.1| glucoside xylosyltransferase 2 precursor [Homo sapiens] MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGAL PGASPGVRRR |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | A0PJZ3 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:33383 | ||||||
| References | |||||||
| General References | Not Available | ||||||