You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
| Identification |
|---|
| HMDB Protein ID
| HMDBP11776 |
| Secondary Accession Numbers
| None |
| Name
| Pseudouridine-5'-monophosphatase |
| Synonyms
|
- 5'-PsiMPase
- Haloacid dehalogenase-like hydrolase domain-containing protein 1
- Haloacid dehalogenase-like hydrolase domain-containing protein 1A
- Protein GS1
|
| Gene Name
| HDHD1 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Dephosphorylates pseudouridine 5'-phosphate, a potential intermediate in rRNA degradation. Pseudouridine is then excreted intact in urine.
|
| Pathways
|
Not Available
|
| Reactions
|
| pseudouridine 5'-monophosphate + Water → Pseudouridine + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| nucleotide metabolic process |
| dephosphorylation |
| Molecular Function |
| metal ion binding |
| phosphatase activity |
| hydrolase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| X |
| Locus
| Xp22.32 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 27572.48 |
| Theoretical pI
| 5.469 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|207113149|ref|NP_001129037.1| pseudouridine-5'-monophosphatase isoform a [Homo sapiens]
MAAPPQPVTHLIFDMDGLLLGYTGSIVAAASGESSRGLQSRWTDTERLYSVVFQEICNRY
DKKYSWDVKS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q08623 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16818 |
| References |
|---|
| General References
| Not Available |
