You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11776
Secondary Accession Numbers None
Name Pseudouridine-5'-monophosphatase
Synonyms
  1. 5'-PsiMPase
  2. Haloacid dehalogenase-like hydrolase domain-containing protein 1
  3. Haloacid dehalogenase-like hydrolase domain-containing protein 1A
  4. Protein GS1
Gene Name HDHD1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Dephosphorylates pseudouridine 5'-phosphate, a potential intermediate in rRNA degradation. Pseudouridine is then excreted intact in urine.
Pathways Not Available
Reactions
pseudouridine 5'-monophosphate + Water → Pseudouridine + Phosphate details
GO Classification
Biological Process
nucleotide metabolic process
dephosphorylation
Molecular Function
metal ion binding
phosphatase activity
hydrolase activity
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xp22.32
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27572.48
Theoretical pI 5.469
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|207113149|ref|NP_001129037.1| pseudouridine-5'-monophosphatase isoform a [Homo sapiens]
MAAPPQPVTHLIFDMDGLLLGYTGSIVAAASGESSRGLQSRWTDTERLYSVVFQEICNRY
DKKYSWDVKS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q08623
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:16818
References
General References Not Available