Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11779
Secondary Accession Numbers None
Name Small RNA 2'-O-methyltransferase
Synonyms
  1. HEN1 methyltransferase homolog 1
Gene Name HENMT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + small RNA → S-Adenosylhomocysteine + small RNA containing a 3'-terminal 2'-O-methylnucleotide details
GO Classification
Biological Process
gene silencing by RNA
piRNA metabolic process
Cellular Component
P granule
Molecular Function
O-methyltransferase activity
metal ion binding
RNA binding
RNA methyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 44524.2
Theoretical pI 5.289
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|156564367|ref|NP_001096062.1| small RNA 2'-O-methyltransferase [Homo sapiens]
MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTS
LLRLLKVNPC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5T8I9
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26400
References
General References Not Available