Showing Protein Small RNA 2'-O-methyltransferase (HMDBP11779)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11779 | ||||||||||
Secondary Accession Numbers | None | ||||||||||
Name | Small RNA 2'-O-methyltransferase | ||||||||||
Synonyms |
|
||||||||||
Gene Name | HENMT1 | ||||||||||
Protein Type | Unknown | ||||||||||
Biological Properties | |||||||||||
General Function | Not Available | ||||||||||
Specific Function | Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis (By similarity). | ||||||||||
Pathways | Not Available | ||||||||||
Reactions |
|
||||||||||
GO Classification |
|
||||||||||
Cellular Location | Not Available | ||||||||||
Gene Properties | |||||||||||
Chromosome Location | 1 | ||||||||||
Locus | 1p13.3 | ||||||||||
SNPs | Not Available | ||||||||||
Gene Sequence | Not Available | ||||||||||
Protein Properties | |||||||||||
Number of Residues | Not Available | ||||||||||
Molecular Weight | 44524.2 | ||||||||||
Theoretical pI | 5.289 | ||||||||||
Pfam Domain Function | Not Available | ||||||||||
Signals | Not Available | ||||||||||
Transmembrane Regions | Not Available | ||||||||||
Protein Sequence |
>>gi|156564367|ref|NP_001096062.1| small RNA 2'-O-methyltransferase [Homo sapiens] MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTS LLRLLKVNPC |
||||||||||
External Links | |||||||||||
GenBank ID Protein | Not Available | ||||||||||
UniProtKB/Swiss-Prot ID | Q5T8I9 | ||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
PDB IDs | Not Available | ||||||||||
GenBank Gene ID | Not Available | ||||||||||
GeneCard ID | Not Available | ||||||||||
GenAtlas ID | Not Available | ||||||||||
HGNC ID | HGNC:26400 | ||||||||||
References | |||||||||||
General References | Not Available |