Showing Protein Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial (HMDBP11784)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11784 | ||||||||||
Secondary Accession Numbers | None | ||||||||||
Name | Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial | ||||||||||
Synonyms |
|
||||||||||
Gene Name | HOGA1 | ||||||||||
Protein Type | Unknown | ||||||||||
Biological Properties | |||||||||||
General Function | Not Available | ||||||||||
Specific Function | Catalyzes the final step in the metabolic pathway of hydroxyproline (Probable). | ||||||||||
Pathways | Not Available | ||||||||||
Reactions |
|
||||||||||
GO Classification |
|
||||||||||
Cellular Location | Not Available | ||||||||||
Gene Properties | |||||||||||
Chromosome Location | 10 | ||||||||||
Locus | 10q24.2 | ||||||||||
SNPs | Not Available | ||||||||||
Gene Sequence | Not Available | ||||||||||
Protein Properties | |||||||||||
Number of Residues | Not Available | ||||||||||
Molecular Weight | 17953.475 | ||||||||||
Theoretical pI | 7.723 | ||||||||||
Pfam Domain Function | Not Available | ||||||||||
Signals | Not Available | ||||||||||
Transmembrane Regions | Not Available | ||||||||||
Protein Sequence |
>>gi|197927274|ref|NP_001128142.1| probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial isoform 2 [Homo sapiens] MLGPQVWSSVRQGLSRSLSRNVGVWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEEN LHKLGTFPFR |
||||||||||
External Links | |||||||||||
GenBank ID Protein | Not Available | ||||||||||
UniProtKB/Swiss-Prot ID | Q86XE5 | ||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
PDB IDs | |||||||||||
GenBank Gene ID | Not Available | ||||||||||
GeneCard ID | Not Available | ||||||||||
GenAtlas ID | Not Available | ||||||||||
HGNC ID | HGNC:25155 | ||||||||||
References | |||||||||||
General References | Not Available |