You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11795
Secondary Accession Numbers None
Name Eukaryotic initiation factor 4A-III
Synonyms
  1. eIF-4A-III
  2. eIF4A-III
  3. ATP-dependent RNA helicase DDX48
  4. ATP-dependent RNA helicase eIF4A-3
  5. DEAD box protein 48
  6. Eukaryotic initiation factor 4A-like NUK-34
  7. Eukaryotic translation initiation factor 4A isoform 3
  8. Nuclear matrix protein 265
  9. NMP 265
  10. hNMP 265
Gene Name EIF4A3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent RNA helicase. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Constitutes at least part of the platform anchoring other EJC proteins to spliced mRNAs. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The inhibition of ATPase activity by the MAGOH/RBM8A heterodimer increases the RNA-binding affinity of the EJC. Involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex. Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions. Shows higher affinity for single-stranded RNA in an ATP-bound core EJC complex than after the ATP is hydrolyzed.
Pathways
  • mRNA surveillance pathway
  • RNA transport
  • Spliceosome
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
mRNA transport
negative regulation of translation
mRNA splicing, via spliceosome
nuclear-transcribed mRNA poly(A) tail shortening
positive regulation of translation
rRNA processing
cytokine-mediated signaling pathway
Cellular Component
cytosol
catalytic step 2 spliceosome
nuclear speck
exon-exon junction complex
Molecular Function
ATP-dependent RNA helicase activity
poly(A) RNA binding
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 46870.62
Theoretical pI 6.72
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7661920|ref|NP_055555.1| eukaryotic initiation factor 4A-III [Homo sapiens]
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEK
PSAIQQRAIK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P38919
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18683
References
General References Not Available