You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11796
Secondary Accession Numbers None
Name Interferon-induced helicase C domain-containing protein 1
Synonyms
  1. Clinically amyopathic dermatomyositis autoantigen 140 kDa
  2. Helicase with 2 CARD domains
  3. Interferon-induced with helicase C domain protein 1
  4. Melanoma differentiation-associated protein 5
  5. Murabutide down-regulated protein
  6. RIG-I-like receptor 2
  7. RNA helicase-DEAD box protein 116
  8. CADM-140 autoantigen
  9. Helicard
  10. MDA-5
  11. RLR-2
Gene Name IFIH1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include mRNA lacking 2'-O-methylation at their 5' cap and long-dsRNA (>1 kb in length). Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Responsible for detecting the Picornaviridae family members such as encephalomyocarditis virus (EMCV) and mengo encephalomyocarditis virus (ENMG). Can also detect other viruses such as dengue virus (DENV), west Nile virus (WNV), and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome, such as vaccinia virus. Plays an important role in amplifying innate immune signaling through recognition of RNA metabolites that are produced during virus infection by ribonuclease L (RNase L). May play an important role in enhancing natural killer cell function and may be involved in growth inhibition and apoptosis in several tumor cell lines.
Pathways
  • Hepatitis B
  • Herpes simplex infection
  • Influenza A
  • Measles
  • RIG-I-like receptor signaling pathway
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
positive regulation of interferon-beta production
cytoplasmic pattern recognition receptor signaling pathway in response to virus
detection of virus
negative regulation of type I interferon production
positive regulation of interferon-alpha production
regulation of type III interferon production
innate immune response
virus-host interaction
regulation of apoptotic process
protein sumoylation
Cellular Component
cytosol
nucleus
Molecular Function
metal ion binding
double-stranded RNA binding
ATP binding
single-stranded RNA binding
zinc ion binding
ribonucleoprotein complex binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 116688.14
Theoretical pI 5.521
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|27886568|ref|NP_071451.2| interferon-induced helicase C domain-containing protein 1 [Homo sapiens]
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BYX4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18873
References
General References Not Available