You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11797 |
Secondary Accession Numbers
| None |
Name
| DNA helicase INO80 |
Synonyms
|
- hINO80
- INO80 complex subunit A
- Putative DNA helicase INO80 complex homolog 1
|
Gene Name
| INO80 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| DNA helicase and probable main scaffold component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; according to PubMed:20687897 the contribution to DNA double-strand break repair appears to be largely indirect through transcriptional regulation. Recruited by YY1 to YY1-activated genes, where it acts as an essential coactivator. Binds DNA. In vitro, has double stranded DNA-dependent ATPase activity. Involved in UV-damage excision repair, DNA replication and chromosome segregation during normal cell division cycle.
|
Pathways
|
Not Available
|
Reactions
|
Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
GO Classification
|
Biological Process |
cell division |
mitotic sister chromatid segregation |
double-strand break repair via homologous recombination |
chromatin remodeling |
cellular response to UV |
positive regulation of DNA replication involved in S phase |
regulation of G1/S transition of mitotic cell cycle |
spindle assembly |
UV-damage excision repair |
positive regulation of transcription from RNA polymerase II promoter |
positive regulation of cell growth |
cellular response to ionizing radiation |
Cellular Component |
Ino80 complex |
microtubule |
Molecular Function |
alpha-tubulin binding |
ATP binding |
ATPase activity |
DNA helicase activity |
DNA binding |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 15 |
Locus
| 15q15.1 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 176751.655 |
Theoretical pI
| 9.501 |
Pfam Domain Function
|
|
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|38708321|ref|NP_060023.1| DNA helicase INO80 [Homo sapiens]
MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
LLPQSGDPLI
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q9ULG1 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:26956 |
References |
General References
| Not Available |