Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11797
Secondary Accession Numbers None
Name DNA helicase INO80
Synonyms
  1. hINO80
  2. INO80 complex subunit A
  3. Putative DNA helicase INO80 complex homolog 1
Gene Name INO80
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA helicase and probable main scaffold component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; according to PubMed:20687897 the contribution to DNA double-strand break repair appears to be largely indirect through transcriptional regulation. Recruited by YY1 to YY1-activated genes, where it acts as an essential coactivator. Binds DNA. In vitro, has double stranded DNA-dependent ATPase activity. Involved in UV-damage excision repair, DNA replication and chromosome segregation during normal cell division cycle.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
cell division
mitotic sister chromatid segregation
double-strand break repair via homologous recombination
chromatin remodeling
cellular response to UV
positive regulation of DNA replication involved in S phase
regulation of G1/S transition of mitotic cell cycle
spindle assembly
UV-damage excision repair
positive regulation of transcription from RNA polymerase II promoter
positive regulation of cell growth
cellular response to ionizing radiation
Cellular Component
Ino80 complex
microtubule
Molecular Function
alpha-tubulin binding
ATP binding
ATPase activity
DNA helicase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus 15q15.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 176751.655
Theoretical pI 9.501
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|38708321|ref|NP_060023.1| DNA helicase INO80 [Homo sapiens]
MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
LLPQSGDPLI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9ULG1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26956
References
General References Not Available