You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11798
Secondary Accession Numbers None
Name Adenylate kinase isoenzyme 6
Synonyms
  1. ATP-AMP transphosphorylase 6
  2. Coilin-interacting nuclear ATPase protein
  3. hCINAP
Gene Name TAF9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Broad activity as an NMP kinase. AMP and dAMP are the preferred substrates of all tested NMPs, but CMP and dCMP are also good substrates. IMP can be phosphorylated, but to a much lesser extent. Adenylate and cytidylate can serve as phosphate acceptors.
Pathways
  • Basal transcription factors
  • Ribosome biogenesis in eukaryotes
Reactions
Adenosine triphosphate + Adenosine monophosphate → ADP details
GO Classification
Cellular Component
Cajal body
Molecular Function
ATP binding
adenylate kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q11.2-q13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 19804.97
Theoretical pI 4.735
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|62865612|ref|NP_001015891.1| adenylate kinase isoenzyme 6 isoform c [Homo sapiens]
MCHRKPGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVD
ELDNQMREGG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y3D8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11542
References
General References Not Available