Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11800
Secondary Accession Numbers None
Name Histone acetyltransferase KAT6A
Synonyms
  1. MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3
  2. Monocytic leukemia zinc finger protein
  3. Runt-related transcription factor-binding protein 2
  4. Zinc finger protein 220
  5. MYST-3
Gene Name KAT6A
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2.
Pathways Not Available
Reactions
Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] details
GO Classification
Biological Process
DNA packaging
somatic stem cell maintenance
histone H3 acetylation
negative regulation of transcription, DNA-dependent
positive regulation of transcription, DNA-dependent
transcription, DNA-dependent
embryonic hemopoiesis
myeloid cell differentiation
nucleosome assembly
Cellular Component
MOZ/MORF histone acetyltransferase complex
nucleosome
Molecular Function
metal ion binding
transcription factor binding
zinc ion binding
transcription coactivator activity
histone acetyltransferase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8p11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 225026.115
Theoretical pI 5.682
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|150378463|ref|NP_001092882.1| histone acetyltransferase KAT6A [Homo sapiens]
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92794
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13013
References
General References Not Available