Showing Protein Katanin p60 ATPase-containing subunit A-like 2 (HMDBP11802)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11802 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | Katanin p60 ATPase-containing subunit A-like 2 | ||||||
| Synonyms |
|
||||||
| Gene Name | KATNAL2 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays (By similarity). | ||||||
| Pathways | Not Available | ||||||
| Reactions |
|
||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 18 | ||||||
| Locus | 18q21.1 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 52780.635 | ||||||
| Theoretical pI | 8.323 | ||||||
| Pfam Domain Function | Not Available | ||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|226371754|ref|NP_112593.2| katanin p60 ATPase-containing subunit A-like 2 [Homo sapiens] MEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKT TAGKTGDTKS |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q8IYT4 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:25387 | ||||||
| References | |||||||
| General References | Not Available | ||||||