You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11804
Secondary Accession Numbers None
Name Probable lysosomal cobalamin transporter
Synonyms
  1. HDAg-L-interacting protein NESI
  2. LMBR1 domain-containing protein 1
  3. Nuclear export signal-interacting protein
Gene Name LMBRD1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV).
Pathways
  • Vitamin digestion and absorption
Reactions Not Available
GO Classification
Biological Process
virus-host interaction
transport
Cellular Component
lysosomal membrane
integral to membrane
Molecular Function
cobalamin binding
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 61387.965
Theoretical pI 7.763
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|261878497|ref|NP_060838.3| probable lysosomal cobalamin transporter [Homo sapiens]
MATSGAASAELVIGWCIFGLLLLAILAFCWIYVRKYQSRRESEVVSTITAIFSLAIALIT
SALLPVDIFL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NUN5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23038
References
General References Not Available