Showing Protein Probable lysosomal cobalamin transporter (HMDBP11804)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11804 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Probable lysosomal cobalamin transporter | ||||||||
| Synonyms |
|
||||||||
| Gene Name | LMBRD1 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV). | ||||||||
| Pathways |
|
||||||||
| Reactions | Not Available | ||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 6 | ||||||||
| Locus | 6q13 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 61387.965 | ||||||||
| Theoretical pI | 7.763 | ||||||||
| Pfam Domain Function |
|
||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|261878497|ref|NP_060838.3| probable lysosomal cobalamin transporter [Homo sapiens] MATSGAASAELVIGWCIFGLLLLAILAFCWIYVRKYQSRRESEVVSTITAIFSLAIALIT SALLPVDIFL |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q9NUN5 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:23038 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||