Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11806
Secondary Accession Numbers None
Name Phosphatidate phosphatase LPIN2
Synonyms
  1. Lipin-2
Gene Name LPIN2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A to modulate lipid metabolism (By similarity).
Pathways
  • Glycerolipid metabolism
  • Glycerophospholipid metabolism
Reactions
A 1,2-diacylglycerol 3-phosphate + Water → a 1,2-diacyl-sn-glycerol + Phosphate details
Phosphatidate + Water → 1,2-Diacyl-sn-glycerol + Phosphate details
GO Classification
Biological Process
phosphatidylethanolamine biosynthetic process
phosphatidylcholine biosynthetic process
fatty acid metabolic process
positive regulation of transcription from RNA polymerase II promoter
triglyceride biosynthetic process
transcription, DNA-dependent
Cellular Component
endoplasmic reticulum membrane
cytosol
nucleus
Molecular Function
phosphatidate phosphatase activity
transcription coactivator activity
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus 18p11.31
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 99398.355
Theoretical pI 5.324
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7662022|ref|NP_055461.1| phosphatidate phosphatase LPIN2 [Homo sapiens]
MNYVGQLAGQVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRS
KEKVIDIEIN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92539
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:14450
References
General References Not Available