You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11807
Secondary Accession Numbers None
Name Phosphatidate phosphatase LPIN3
Synonyms
  1. Lipin-3
  2. Lipin-3-like
Gene Name LPIN3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Regulates fatty acid metabolism. Magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis (By similarity).
Pathways
  • Glycerolipid metabolism
  • Glycerophospholipid metabolism
Reactions
A 1,2-diacylglycerol 3-phosphate + Water → a 1,2-diacyl-sn-glycerol + Phosphate details
Phosphatidate + Water → 1,2-Diacyl-sn-glycerol + Phosphate details
GO Classification
Biological Process
phosphatidylethanolamine biosynthetic process
phosphatidylcholine biosynthetic process
fatty acid metabolic process
Cellular Component
endoplasmic reticulum membrane
nucleus
Molecular Function
phosphatidate phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 20
Locus 20q12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 93613.4
Theoretical pI 5.511
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|74271888|ref|NP_075047.1| phosphatidate phosphatase LPIN3 [Homo sapiens]
MNYVGQLAETVFGTVKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRS
REKVVDIELN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BQK8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:14451
References
General References Not Available