You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Putative helicase Mov10l1 (HMDBP11808)
Identification | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11808 | |||||||||||
Secondary Accession Numbers | None | |||||||||||
Name | Putative helicase Mov10l1 | |||||||||||
Synonyms |
|
|||||||||||
Gene Name | MOV10L1 | |||||||||||
Protein Type | Unknown | |||||||||||
Biological Properties | ||||||||||||
General Function | Not Available | |||||||||||
Specific Function | Putative RNA helicase. Isoform 1 may play a role in male germ cell development. | |||||||||||
Pathways | Not Available | |||||||||||
Reactions |
|
|||||||||||
GO Classification |
|
|||||||||||
Cellular Location | Not Available | |||||||||||
Gene Properties | ||||||||||||
Chromosome Location | 22 | |||||||||||
Locus | 22q13.33 | |||||||||||
SNPs | Not Available | |||||||||||
Gene Sequence | Not Available | |||||||||||
Protein Properties | ||||||||||||
Number of Residues | Not Available | |||||||||||
Molecular Weight | 129935.8 | |||||||||||
Theoretical pI | 6.245 | |||||||||||
Pfam Domain Function | Not Available | |||||||||||
Signals | Not Available | |||||||||||
Transmembrane Regions | Not Available | |||||||||||
Protein Sequence |
>>gi|255759906|ref|NP_001157576.1| putative helicase Mov10l1 isoform 2 [Homo sapiens] MLSLAAKLVAFFWRTADTPREEAGQLEPELAEGDTKLKTVRGVVTRYCSDYGMIDDMIYF SSDAVTSRVL |
|||||||||||
External Links | ||||||||||||
GenBank ID Protein | Not Available | |||||||||||
UniProtKB/Swiss-Prot ID | Q9BXT6 | |||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||
PDB IDs | Not Available | |||||||||||
GenBank Gene ID | Not Available | |||||||||||
GeneCard ID | Not Available | |||||||||||
GenAtlas ID | Not Available | |||||||||||
HGNC ID | HGNC:7201 | |||||||||||
References | ||||||||||||
General References | Not Available |