You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11808
Secondary Accession Numbers None
Name Putative helicase Mov10l1
Synonyms
  1. Moloney leukemia virus 10-like protein 1
  2. MOV10-like protein 1
Gene Name MOV10L1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Putative RNA helicase. Isoform 1 may play a role in male germ cell development.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
multicellular organismal development
spermatogenesis
germ cell development
Cellular Component
intracellular
Molecular Function
magnesium ion binding
ATP-dependent RNA helicase activity
ATP binding
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q13.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 129935.8
Theoretical pI 6.245
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|255759906|ref|NP_001157576.1| putative helicase Mov10l1 isoform 2 [Homo sapiens]
MLSLAAKLVAFFWRTADTPREEAGQLEPELAEGDTKLKTVRGVVTRYCSDYGMIDDMIYF
SSDAVTSRVL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BXT6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7201
References
General References Not Available