You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11809
Secondary Accession Numbers None
Name Alpha-mannosidase 2x
Synonyms
  1. Alpha-mannosidase IIx
  2. Mannosidase alpha class 2A member 2
  3. Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
  4. Man IIx
Gene Name MAN2A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
+ Water → + D-Mannose details
GO Classification
Biological Process
post-translational protein modification
protein N-linked glycosylation via asparagine
mannose metabolic process
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
metal ion binding
carbohydrate binding
zinc ion binding
mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus 15q26.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 130537.495
Theoretical pI 6.838
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|51477716|ref|NP_006113.2| alpha-mannosidase 2x [Homo sapiens]
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P49641
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:6825
References
General References Not Available