Showing Protein Alpha-mannosidase 2x (HMDBP11809)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11809 | ||||||||||||
Secondary Accession Numbers | None | ||||||||||||
Name | Alpha-mannosidase 2x | ||||||||||||
Synonyms |
|
||||||||||||
Gene Name | MAN2A2 | ||||||||||||
Protein Type | Unknown | ||||||||||||
Biological Properties | |||||||||||||
General Function | Not Available | ||||||||||||
Specific Function | Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway. | ||||||||||||
Pathways |
|
||||||||||||
Reactions |
|
||||||||||||
GO Classification |
|
||||||||||||
Cellular Location | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Chromosome Location | 15 | ||||||||||||
Locus | 15q26.1 | ||||||||||||
SNPs | Not Available | ||||||||||||
Gene Sequence | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Number of Residues | Not Available | ||||||||||||
Molecular Weight | 130537.495 | ||||||||||||
Theoretical pI | 6.838 | ||||||||||||
Pfam Domain Function | Not Available | ||||||||||||
Signals | Not Available | ||||||||||||
Transmembrane Regions | Not Available | ||||||||||||
Protein Sequence |
>>gi|51477716|ref|NP_006113.2| alpha-mannosidase 2x [Homo sapiens] MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL LEENHEIISH |
||||||||||||
External Links | |||||||||||||
GenBank ID Protein | Not Available | ||||||||||||
UniProtKB/Swiss-Prot ID | P49641 | ||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
PDB IDs | Not Available | ||||||||||||
GenBank Gene ID | Not Available | ||||||||||||
GeneCard ID | Not Available | ||||||||||||
GenAtlas ID | Not Available | ||||||||||||
HGNC ID | HGNC:6825 | ||||||||||||
References | |||||||||||||
General References | Not Available |