You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11810
Secondary Accession Numbers None
Name Lysosomal alpha-mannosidase
Synonyms
  1. Laman
  2. Lysosomal acid alpha-mannosidase
  3. Mannosidase alpha class 2B member 1
  4. Mannosidase alpha-B
Gene Name MAN2B1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Necessary for the catabolism of N-linked carbohydrates released during glycoprotein turnover. Cleaves all known types of alpha-mannosidic linkages.
Pathways
  • Lysosome
  • Other glycan degradation
Reactions
+ Water → + D-Mannose details
+ Water → + D-Mannose details
GO Classification
Biological Process
learning or memory
protein deglycosylation
mannose metabolic process
Cellular Component
lysosome
Molecular Function
metal ion binding
mannose binding
zinc ion binding
alpha-mannosidase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19cen-q13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 113743.26
Theoretical pI 7.282
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|51873064|ref|NP_000519.2| lysosomal alpha-mannosidase isoform 1 precursor [Homo sapiens]
MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQP
NMLNVHLLPH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O00754
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:6826
References
General References Not Available