Showing Protein Lysosomal alpha-mannosidase (HMDBP11810)
Identification | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11810 | |||||||||||
Secondary Accession Numbers | None | |||||||||||
Name | Lysosomal alpha-mannosidase | |||||||||||
Synonyms |
|
|||||||||||
Gene Name | MAN2B1 | |||||||||||
Protein Type | Unknown | |||||||||||
Biological Properties | ||||||||||||
General Function | Not Available | |||||||||||
Specific Function | Necessary for the catabolism of N-linked carbohydrates released during glycoprotein turnover. Cleaves all known types of alpha-mannosidic linkages. | |||||||||||
Pathways |
|
|||||||||||
Reactions |
|
|||||||||||
GO Classification |
|
|||||||||||
Cellular Location | Not Available | |||||||||||
Gene Properties | ||||||||||||
Chromosome Location | 19 | |||||||||||
Locus | 19cen-q13.1 | |||||||||||
SNPs | Not Available | |||||||||||
Gene Sequence | Not Available | |||||||||||
Protein Properties | ||||||||||||
Number of Residues | Not Available | |||||||||||
Molecular Weight | 113743.26 | |||||||||||
Theoretical pI | 7.282 | |||||||||||
Pfam Domain Function | Not Available | |||||||||||
Signals | Not Available | |||||||||||
Transmembrane Regions | Not Available | |||||||||||
Protein Sequence |
>>gi|51873064|ref|NP_000519.2| lysosomal alpha-mannosidase isoform 1 precursor [Homo sapiens] MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQP NMLNVHLLPH |
|||||||||||
External Links | ||||||||||||
GenBank ID Protein | Not Available | |||||||||||
UniProtKB/Swiss-Prot ID | O00754 | |||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||
PDB IDs | Not Available | |||||||||||
GenBank Gene ID | Not Available | |||||||||||
GeneCard ID | Not Available | |||||||||||
GenAtlas ID | Not Available | |||||||||||
HGNC ID | HGNC:6826 | |||||||||||
References | ||||||||||||
General References | Not Available |