You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11812
Secondary Accession Numbers None
Name Magnesium transporter protein 1
Synonyms
  1. MagT1
  2. Implantation-associated protein
  3. IAP
Gene Name MAGT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May be involved in N-glycosylation through its association with N-oligosaccharyl transferase. May be involved in Mg(2+) transport in epithelial cells.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
protein N-linked glycosylation
cognition
Cellular Component
oligosaccharyltransferase complex
integral to plasma membrane
Molecular Function
magnesium ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xq21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 41531.49
Theoretical pI 9.942
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|215983058|ref|NP_115497.4| magnesium transporter protein 1 [Homo sapiens]
MRKGKGPICLFSRPTLRPSRSKVSLIEGRGANMAARWRFWCVSVTMVVALLIVCDVPSAS
AQRKKEMVLS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H0U3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28880
References
General References Not Available