You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11815
Secondary Accession Numbers None
Name Lysophospholipid acyltransferase 7
Synonyms
  1. LPLAT 7
  2. 1-acylglycerophosphatidylinositol O-acyltransferase
  3. Bladder and breast carcinoma-overexpressed gene 1 protein
  4. Leukocyte receptor cluster member 4
  5. Lysophosphatidylinositol acyltransferase
  6. Membrane-bound O-acyltransferase domain-containing protein 7
  7. LPIAT
  8. Lyso-PI acyltransferase
  9. O-acyltransferase domain-containing protein 7
  10. h-mboa-7
Gene Name MBOAT7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acyltransferase which mediates the conversion of lysophosphatidylinositol (1-acylglycerophosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3-phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
Pathways
  • Glycerophospholipid metabolism
  • phospholipid metabolism
Reactions
Acyl-CoA + 1-acyl-sn-glycero-3-phosphatidylinositol → Coenzyme A + 1,2-diacyl-sn-glycero-3-phosphatidylinositol details
Acyl-[acyl-carrier-protein] + 1-acyl-sn-glycerol 3-phosphate → [acyl-carrier-protein] + 1,2-diacyl-sn-glycerol 3-phosphate details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylinositol acyl-chain remodeling
glycerophospholipid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
transferase activity, transferring acyl groups other than amino-acyl groups
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.4
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 44732.46
Theoretical pI 8.863
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|225703081|ref|NP_001139528.1| lysophospholipid acyltransferase 7 isoform 2 [Homo sapiens]
MGSSRCGPGAHPVHLWPPHFAFSGHHPRDLGPHSGPALLVSLASEVQDLHLAQRKEMASG
FSKGPTLGLL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96N66
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:15505
References
General References Not Available