Identification |
HMDB Protein ID
| HMDBP11817 |
Secondary Accession Numbers
| None |
Name
| DNA replication licensing factor MCM3 |
Synonyms
|
- DNA polymerase alpha holoenzyme-associated protein P1
- P1-MCM3
- RLF subunit beta
- p102
|
Gene Name
| MCM3 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation.
|
Pathways
|
- Cell cycle
- DNA replication
|
Reactions
|
Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
GO Classification
|
Biological Process |
S phase of mitotic cell cycle |
G1/S transition of mitotic cell cycle |
cell cycle checkpoint |
DNA strand elongation involved in DNA replication |
DNA replication initiation |
M/G1 transition of mitotic cell cycle |
Cellular Component |
centrosome |
perinuclear region of cytoplasm |
nucleoplasm |
alpha DNA polymerase:primase complex |
MCM complex |
Molecular Function |
ATP binding |
DNA binding |
helicase activity |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 6 |
Locus
| 6p12 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 91929.485 |
Theoretical pI
| 6.332 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|394582099|ref|NP_001257401.1| DNA replication licensing factor MCM3 isoform 2 [Homo sapiens]
MLICSQGPRLFLEVTFGGGKSSEVFAPGWSHPGNLHATLVEVVLWQRAWRVPWCWTMWSC
GRLREITWTS
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| P25205 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:6945 |
References |
General References
| Not Available |