You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11819
Secondary Accession Numbers None
Name DNA replication licensing factor MCM5
Synonyms
  1. CDC46 homolog
  2. P1-CDC46
Gene Name MCM5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (By similarity). Interacts with MCMBP.
Pathways
  • Cell cycle
  • DNA replication
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
S phase of mitotic cell cycle
G1/S transition of mitotic cell cycle
cell cycle checkpoint
DNA strand elongation involved in DNA replication
DNA replication initiation
M/G1 transition of mitotic cell cycle
Cellular Component
nucleoplasm
MCM complex
Molecular Function
ATP binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 82284.685
Theoretical pI 8.371
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|23510448|ref|NP_006730.2| DNA replication licensing factor MCM5 [Homo sapiens]
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P33992
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:6948
References
General References Not Available