You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11820
Secondary Accession Numbers None
Name DNA helicase MCM8
Synonyms
  1. Minichromosome maintenance 8
Gene Name MCM8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
S phase of mitotic cell cycle
G1/S transition of mitotic cell cycle
DNA repair
response to DNA damage stimulus
cell cycle checkpoint
DNA strand elongation involved in DNA replication
M/G1 transition of mitotic cell cycle
female gamete generation
male gamete generation
Cellular Component
nucleoplasm
MCM8-MCM9 complex
Molecular Function
ATP binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 20
Locus 20p12.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 93695.955
Theoretical pI 7.749
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|19923727|ref|NP_115874.3| DNA helicase MCM8 isoform 1 [Homo sapiens]
MNGEYRGRGFGRGRFQSWKRGRGGGNFSGKWREREHRPDLSKTTGKRTSEQTPQFLLSTK
TPQSMQSTLD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UJA3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:16147
References
General References Not Available