| Identification |
|---|
| HMDB Protein ID
| HMDBP11826 |
| Secondary Accession Numbers
| None |
| Name
| Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase |
| Synonyms
|
- N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
- GNT-I
- GlcNAc-T I
|
| Gene Name
| MGAT1 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Initiates complex N-linked carbohydrate formation. Essential for the conversion of high-mannose to hybrid and complex N-glycans.
|
| Pathways
|
- N-Glycan biosynthesis
- protein glycosylation
|
| Reactions
|
| Uridine diphosphate-N-acetylglucosamine + 3-(alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R |
details
|
| UDP-N-acetyl-D-glucosamine + → UDP + |
details
|
|
| GO Classification
|
| Biological Process |
| in utero embryonic development |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| UDP-N-acetylglucosamine catabolic process |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| metal ion binding |
| acetylglucosaminyltransferase activity |
| alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q35 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 50877.88 |
| Theoretical pI
| 9.161 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|167857780|ref|NP_001108089.1| alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase [Homo sapiens]
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRG
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P26572 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:7044 |
| References |
|---|
| General References
| Not Available |
