Hmdb loader
Identification
HMDB Protein ID HMDBP11827
Secondary Accession Numbers None
Name Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
Synonyms
  1. N-acetylglucosaminyltransferase IV homolog
  2. N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVc
  3. UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVc
  4. hGnT-IV-H
  5. GlcNAc-T IVc
  6. GnT-IVc
  7. N-acetylglucosaminyltransferase IVc
Gene Name MGAT4C
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains (By similarity). Does not catalyze the transfer of GlcNAc to the Manalpha1-6 arm to form GlcNAcBeta1-4Manalpha1-6 linkage ('GnT-VI' activity).
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R details
UDP-N-acetyl-D-glucosamine + → UDP + details
GO Classification
Biological Process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
metal ion binding
alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56060.915
Theoretical pI 8.157
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|166197698|ref|NP_037376.2| alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C [Homo sapiens]
MFKFHQMKHIFEILDKMRCLRKRSTVSFLGVLVIFLLFMNLYIEDSYVLEGDKQLIRETS
THQLNSERYV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UBM8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30871
References
General References Not Available